![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf08755g01011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 78aa MW: 8813.94 Da PI: 8.7996 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 63.7 | 6.7e-20 | 35 | 78 | 5 | 48 |
TCP 5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdskti 48 k k hTkv+gR+RR+ ++a+ca r+F+L++e G+++d++ti Niben101Scf08755g01011.1 35 KEDETKKHTKVEGRGRRISMPALCATRIFQLTRESGHKSDGETI 78 4456688************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 14.474 | 35 | 78 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 4.8E-13 | 39 | 78 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MDPKQPPTQS NAININNSNN NIMVECNKPI HDQIKEDETK KHTKVEGRGR RISMPALCAT 60 RIFQLTRESG HKSDGETI |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009624132.1 | 2e-30 | PREDICTED: transcription factor TCP20 | ||||
Swissprot | O64647 | 3e-18 | TCP9_ARATH; Transcription factor TCP9 | ||||
TrEMBL | K4B7F2 | 1e-20 | K4B7F2_SOLLC; Uncharacterized protein | ||||
TrEMBL | G3BGV8 | 1e-20 | G3BGV8_SOLLC; TCP transcription factor 18 | ||||
STRING | Solyc02g068200.1.1 | 4e-20 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA248 | 24 | 201 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45680.1 | 7e-19 | TCP family protein |